EPO antibody (Middle Region)

Catalog No. ABIN635113

Product Details anti-EPO Antibody

Target: EPO (Erythropoietin (EPO))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPO antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EPO antibody was raised against the middle region of EPO

Purification: Affinity purified

Immunogen: EPO antibody was raised using the middle region of EPO corresponding to a region with amino acids KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EPO Blocking Peptide, catalog no. 33R-4315, is also available for use as a blocking control in assays to test for specificity of this EPO antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EPO

Target: EPO (Erythropoietin (EPO))

Alternative Name: EPO (EPO Products)

Synonyms: EPO antibody, EP antibody, MVCD2 antibody, erythropoietin antibody, erythropoietin S homeolog antibody, erythropoietin a antibody, EPO antibody, epo antibody, epo.S antibody, Epo antibody, epoa antibody

Target Type: Hormone

Background: This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.

Molecular Weight: 18 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Hormone Activity, Negative Regulation of intrinsic apoptotic Signaling, Negative Regulation of Transporter Activity