ACSL5 antibody (C-Term)

Catalog No. ABIN635129

Product Details anti-ACSL5 Antibody

Target: ACSL5 (Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACSL5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACSL5 antibody was raised against the C terminal of ACSL5

Purification: Affinity purified

Immunogen: ACSL5 antibody was raised using the C terminal of ACSL5 corresponding to a region with amino acids ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACSL5 Blocking Peptide, catalog no. 33R-1075, is also available for use as a blocking control in assays to test for specificity of this ACSL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACSL5

Target: ACSL5 (Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5))

Alternative Name: ACSL5 (ACSL5 Products)

Synonyms: ACSL5 antibody, acs2 antibody, acs5 antibody, facl5 antibody, ACS2 antibody, ACS5 antibody, FACL5 antibody, 1700030F05Rik antibody, Facl5 antibody, Acs5 antibody, zgc:92083 antibody, acyl-CoA synthetase long chain family member 5 antibody, acyl-CoA synthetase long-chain family member 5 antibody, ACSL5 antibody, acsl5 antibody, Acsl5 antibody

Background: ASCL5 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Molecular Weight: 76 kDa (MW of target protein)