GPR177/WLS antibody (N-Term)

Catalog No. ABIN635133

This anti-GPR177/WLS antibody is a Rabbit Polyclonal antibody detecting GPR177/WLS in WB and IHC. Suitable for Human, Mouse and Dog.

Quick Overview for GPR177/WLS antibody (N-Term) (ABIN635133)

Target: GPR177/WLS (WLS) (Wntless Homolog (WLS))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPR177/WLS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-GPR177/WLS Antibody

Binding Specificity: N-Term

Specificity: GPR177 antibody was raised against the N terminal of GPR177

Purification: Affinity purified

Immunogen: GPR177 antibody was raised using the N terminal of GPR177 corresponding to a region with amino acids ARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHME

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPR177 Blocking Peptide, (ABIN936863), is also available for use as a blocking control in assays to test for specificity of this GPR177 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR177 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPR177/WLS

Target: GPR177/WLS (WLS) (Wntless Homolog (WLS))

Alternative Name: GPR177

Background: GPR177 is a receptor for Wnt proteins in Wnt-secreting cells.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: WNT Signaling