Anoctamin 6 antibody (Middle Region)

Catalog No. ABIN635138

The Rabbit Polyclonal anti-Anoctamin 6 antibody is suitable to detect Anoctamin 6 in samples from Human. It has been validated for WB.

Quick Overview for Anoctamin 6 antibody (Middle Region) (ABIN635138)

Target: Anoctamin 6 (ANO6)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Anoctamin 6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Anoctamin 6 Antibody

Binding Specificity: Middle Region

Specificity: Anoctamin 6 antibody was raised against the middle region of ANO6

Purification: Affinity purified

Immunogen: Anoctamin 6 antibody was raised using the middle region of ANO6 corresponding to a region with amino acids KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Anoctamin 6 Blocking Peptide, (ABIN940037), is also available for use as a blocking control in assays to test for specificity of this Anoctamin 6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANO6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Anoctamin 6

Target: Anoctamin 6 (ANO6)

Alternative Name: Anoctamin 6

Background: TMEM16F may act as a calcium-activated chloride channel.

Molecular Weight: 106 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome