Synaptophysin antibody (N-Term)

Catalog No. ABIN635142

This anti-Synaptophysin antibody is a Rabbit Polyclonal antibody detecting Synaptophysin in WB. Suitable for Human, Rat and Mouse.

Quick Overview for Synaptophysin antibody (N-Term) (ABIN635142)

Target: Synaptophysin (SYP)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Synaptophysin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Synaptophysin Antibody

Binding Specificity: N-Term

Specificity: Synaptophysin antibody was raised against the N terminal of SYP

Purification: Affinity purified

Immunogen: Synaptophysin antibody was raised using the N terminal of SYP corresponding to a region with amino acids MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Synaptophysin Blocking Peptide, catalog no. 33R-6191, is also available for use as a blocking control in assays to test for specificity of this Synaptophysin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Synaptophysin

Target: Synaptophysin (SYP)

Alternative Name: Synaptophysin

Background: Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of long-term Neuronal Synaptic Plasticity