Acsl3 antibody (N-Term)

Catalog No. ABIN635143

This Rabbit Polyclonal antibody specifically detects Acsl3 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for Acsl3 antibody (N-Term) (ABIN635143)

Target: Acsl3 (Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Acsl3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Acsl3 Antibody

Binding Specificity: N-Term

Specificity: ACSL3 antibody was raised against the N terminal of ACSL3

Purification: Affinity purified

Immunogen: ACSL3 antibody was raised using the N terminal of ACSL3 corresponding to a region with amino acids LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACSL3 Blocking Peptide, (ABIN940231), is also available for use as a blocking control in assays to test for specificity of this ACSL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Acsl3

Target: Acsl3 (Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3))

Alternative Name: ACSL3

Background: ACSL3 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates.

Molecular Weight: 80 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome