FMO3 antibody (N-Term)

Catalog No. ABIN635154

This anti-FMO3 antibody is a Rabbit Polyclonal antibody detecting FMO3 in WB. Suitable for Human.

Quick Overview for FMO3 antibody (N-Term) (ABIN635154)

Target: FMO3 (Flavin Containing Monooxygenase 3 (FMO3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FMO3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FMO3 Antibody

Binding Specificity: N-Term

Specificity: FMO3 antibody was raised against the N terminal of FMO3

Purification: Affinity purified

Immunogen: FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FMO3 Blocking Peptide, (ABIN5613622), is also available for use as a blocking control in assays to test for specificity of this FMO3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FMO3

Target: FMO3 (Flavin Containing Monooxygenase 3 (FMO3))

Alternative Name: FMO3

Background: FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.

Molecular Weight: 60 kDa (MW of target protein)