UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 18 (GALNT18) (Middle Region) antibody

Catalog No. ABIN635162

Product Details

Target: UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 18 (GALNT18)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: GALNTL4 antibody was raised against the middle region of GALNTL4

Purification: Affinity purified

Immunogen: GALNTL4 antibody was raised using the middle region of GALNTL4 corresponding to a region with amino acids IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALNTL4 Blocking Peptide, catalog no. 33R-3993, is also available for use as a blocking control in assays to test for specificity of this GALNTL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNTL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 18 (GALNT18)

Alternative Name: GALNTL4 (GALNT18 Products)

Synonyms: GALNACT18 antibody, GALNT15 antibody, GALNTL4 antibody, GalNAc-T15 antibody, GalNAc-T18 antibody, 2900011G21Rik antibody, BC024988 antibody, Galntl4 antibody, RGD1309623 antibody, galntl4a antibody, zgc:194153 antibody, polypeptide N-acetylgalactosaminyltransferase 18 antibody, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 18a antibody, GALNT18 antibody, Galnt18 antibody, galnt18a antibody

Background: GALNTL4 may catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.

Molecular Weight: 69 kDa (MW of target protein)