DLL4 antibody

Catalog No. ABIN635181

This anti-DLL4 antibody is a Rabbit Polyclonal antibody detecting DLL4 in WB. Suitable for Human.

Quick Overview for DLL4 antibody (ABIN635181)

Target: DLL4 (delta-Like 4 (DLL4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLL4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DLL4 Antibody

Purification: Affinity purified

Immunogen: DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLL4 Blocking Peptide, (ABIN5613220), is also available for use as a blocking control in assays to test for specificity of this DLL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLL4

Target: DLL4 (delta-Like 4 (DLL4))

Alternative Name: DLL4

Background: Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4.

Molecular Weight: 72 kDa (MW of target protein)

Pathways: Notch Signaling