DLL4 antibody
-
- Target See all DLL4 Antibodies
- DLL4 (delta-Like 4 (DLL4))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DLL4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF
- Top Product
- Discover our top product DLL4 Primary Antibody
-
-
- Application Notes
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DLL4 Blocking Peptide, catalog no. 33R-7573, is also available for use as a blocking control in assays to test for specificity of this DLL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLL4 (delta-Like 4 (DLL4))
- Alternative Name
- DLL4 (DLL4 Products)
- Background
- Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4.
- Molecular Weight
- 72 kDa (MW of target protein)
- Pathways
- Notch Signaling
-