LPCAT1 antibody (Middle Region)

Catalog No. ABIN635206

Product Details anti-LPCAT1 Antibody

Target: LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LPCAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LPCAT1 antibody was raised against the middle region of LPCAT1

Purification: Affinity purified

Immunogen: LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LPCAT1 Blocking Peptide, catalog no. 33R-5370, is also available for use as a blocking control in assays to test for specificity of this LPCAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPCAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LPCAT1

Target: LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))

Alternative Name: LPCAT1 (LPCAT1 Products)

Synonyms: AYTL2 antibody, Aytl2 antibody, RGD1311599 antibody, PFAAP3 antibody, lpcat antibody, si:dkey-261i16.4 antibody, zgc:158232 antibody, 2900035H07Rik antibody, BB137372 antibody, BC005662 antibody, C87117 antibody, LPCAT antibody, rd11 antibody, lysophosphatidylcholine acyltransferase 1 antibody, LPCAT1 antibody, Lpcat1 antibody, lpcat1 antibody

Background: Lysophosphatidylcholine (LPC) acyltransferase (LPCAT, EC 2.3.1.23) catalyzes the conversion of LPC to phosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis.

Molecular Weight: 59 kDa (MW of target protein)