SFXN3 antibody (Middle Region)
-
- Target See all SFXN3 Antibodies
- SFXN3 (Sideroflexin 3 (SFXN3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SFXN3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Sideroflexin 3 antibody was raised against the middle region of SFXN3
- Purification
- Affinity purified
- Immunogen
- Sideroflexin 3 antibody was raised using the middle region of SFXN3 corresponding to a region with amino acids TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN
- Top Product
- Discover our top product SFXN3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Sideroflexin 3 Blocking Peptide, catalog no. 33R-9223, is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFXN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFXN3 (Sideroflexin 3 (SFXN3))
- Alternative Name
- Sideroflexin 3 (SFXN3 Products)
- Synonyms
- xm278 antibody, BA108L7.2 antibody, SFX3 antibody, TCC antibody, sideroflexin 3 L homeolog antibody, sideroflexin 3 antibody, sfxn3.L antibody, SFXN3 antibody, Sfxn3 antibody
- Background
- SFXN3 is a potential iron transporter.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-