ANKH antibody

Catalog No. ABIN635227

Product Details anti-ANKH Antibody

Target: ANKH (Ankylosis, Progressive Homolog (Mouse) (ANKH))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKH antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ANKH antibody was raised using a synthetic peptide corresponding to a region with amino acids SDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKH Blocking Peptide, catalog no. 33R-8361, is also available for use as a blocking control in assays to test for specificity of this ANKH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKH

Target: ANKH (Ankylosis, Progressive Homolog (Mouse) (ANKH))

Alternative Name: ANKH (ANKH Products)

Synonyms: ANK antibody, CCAL2 antibody, CMDJ antibody, CPPDD antibody, HANK antibody, MANK antibody, Ank antibody, Ankh antibody, D15Ertd221e antibody, ank antibody, mKIAA1581 antibody, ankh antibody, wu:fc08d03 antibody, wu:fj64g09 antibody, zgc:110290 antibody, ANKH inorganic pyrophosphate transport regulator antibody, progressive ankylosis antibody, ANKH inorganic pyrophosphate transport regulator b antibody, ANKH inorganic pyrophosphate transport regulator S homeolog antibody, ANKH inorganic pyrophosphate transport regulator a antibody, ANKH antibody, Ankh antibody, Ank antibody, ankhb antibody, ankh.S antibody, ankha antibody

Background: ANKH regulates intra- and extracellular levels of inorganic pyrophosphate (PPi), probably functioning as PPi transporter.

Molecular Weight: 54 kDa (MW of target protein)