Vip antibody (Middle Region)
-
- Target See all Vip Antibodies
- Vip (Vasoactive Intestinal Peptide (Vip))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Vip antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- VIP antibody was raised against the middle region of VIP
- Purification
- Affinity purified
- Immunogen
- VIP antibody was raised using the middle region of VIP corresponding to a region with amino acids VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELE
- Top Product
- Discover our top product Vip Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VIP Blocking Peptide, catalog no. 33R-9742, is also available for use as a blocking control in assays to test for specificity of this VIP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Vip (Vasoactive Intestinal Peptide (Vip))
- Alternative Name
- VIP (Vip Products)
- Background
- The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
- Molecular Weight
- 3 kDa (MW of target protein)
- Pathways
- Hormone Activity, cAMP Metabolic Process
-