Vip antibody (Middle Region)

Catalog No. ABIN635234

Product Details anti-Vip Antibody

Target: Vip (Vasoactive Intestinal Peptide (Vip))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Vip antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VIP antibody was raised against the middle region of VIP

Purification: Affinity purified

Immunogen: VIP antibody was raised using the middle region of VIP corresponding to a region with amino acids VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VIP Blocking Peptide, catalog no. 33R-9742, is also available for use as a blocking control in assays to test for specificity of this VIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Vip

Target: Vip (Vasoactive Intestinal Peptide (Vip))

Alternative Name: VIP (Vip Products)

Synonyms: PHM27 antibody, vip1 antibody, zgc:171463 antibody, VIP antibody, vip-A antibody, PHI antibody, vasoactive intestinal peptide antibody, vasoactive intestinal peptide L homeolog antibody, vasoactive intestinal polypeptide antibody, VIP antibody, Vip antibody, vip antibody, vip.L antibody

Background: The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Molecular Weight: 3 kDa (MW of target protein)

Pathways: Hormone Activity, cAMP Metabolic Process