C19orf46 antibody (N-Term)

Catalog No. ABIN635247

Product Details anti-C19orf46 Antibody

Target: C19orf46 (Chromosome 19 Open Reading Frame 46 (C19orf46))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C19orf46 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C19 ORF46 antibody was raised against the N terminal Of C19 rf46

Purification: Affinity purified

Immunogen: C19 ORF46 antibody was raised using the N terminal Of C19 rf46 corresponding to a region with amino acids GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C19ORF46 Blocking Peptide, catalog no. 33R-3224, is also available for use as a blocking control in assays to test for specificity of this C19ORF46 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C19orf46

Target: C19orf46 (Chromosome 19 Open Reading Frame 46 (C19orf46))

Alternative Name: C19ORF46 (C19orf46 Products)

Synonyms: C19orf46 antibody, Nesp4 antibody, C18H19orf46 antibody, 0610012K07Rik antibody, AI428936 antibody, RGD1304580 antibody, C1H19orf46 antibody, spectrin repeat containing nuclear envelope family member 4 antibody, spectrin repeat containing, nuclear envelope family member 4 antibody, SYNE4 antibody, Syne4 antibody

Background: C19orf46 contributes to the establishment of secretory epithelial morphology by promoting kinesin-dependent apical migration of the centrosome and Golgi apparatus and basal localization of the nucleus.

Molecular Weight: 43 kDa (MW of target protein)