Tetraspanin 17 antibody (N-Term)

Catalog No. ABIN635252

Product Details anti-Tetraspanin 17 Antibody

Target: Tetraspanin 17 (TSPAN17)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tetraspanin 17 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Tetraspanin 17 antibody was raised against the N terminal of TSPAN17

Purification: Affinity purified

Immunogen: Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 17 Blocking Peptide, catalog no. 33R-3647, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tetraspanin 17

Target: Tetraspanin 17 (TSPAN17)

Alternative Name: Tetraspanin 17 (TSPAN17 Products)

Synonyms: fc49c03 antibody, wu:fc49c03 antibody, zgc:158284 antibody, Tspan-17 antibody, fbxo23 antibody, MGC89422 antibody, GB11399 antibody, tetraspanin 17 antibody, FBX23 antibody, FBXO23 antibody, TM4SF17 antibody, 2210021G21Rik antibody, AI047581 antibody, Fbxo23 antibody, Tm4sf17 antibody, GHB-R antibody, tetraspanin 17 antibody, tetraspanin 17 S homeolog antibody, CD63 antigen antibody, tetraspanin-17 protein antibody, tspan17 antibody, tspan17.S antibody, TSPAN17 antibody, LOC552721 antibody, TET17 antibody, Tspan17 antibody

Background: The function of Tetraspanin 17 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 37 kDa (MW of target protein)