SLC45A2 antibody (C-Term)

Catalog No. ABIN635265

Product Details anti-SLC45A2 Antibody

Target: SLC45A2 (Solute Carrier Family 45, Member 2 (SLC45A2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC45A2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC45 A2 antibody was raised against the C terminal of SLC45 2

Purification: Affinity purified

Immunogen: SLC45 A2 antibody was raised using the C terminal of SLC45 2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC45A2 Blocking Peptide, catalog no. 33R-3980, is also available for use as a blocking control in assays to test for specificity of this SLC45A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC45A2

Target: SLC45A2 (Solute Carrier Family 45, Member 2 (SLC45A2))

Alternative Name: SLC45A2 (SLC45A2 Products)

Synonyms: SLC45A2 antibody, matp antibody, aim1 antibody, im:7138762 antibody, MGC114950 antibody, 1A1 antibody, AIM1 antibody, MATP antibody, OCA4 antibody, SHEP5 antibody, Aim-1 antibody, Aim1 antibody, Dbr antibody, Matp antibody, blanc-sale antibody, bls antibody, uw antibody, solute carrier family 45 member 2 antibody, solute carrier family 45, member 2 antibody, solute carrier family 45 member 2 L homeolog antibody, SLC45A2 antibody, slc45a2 antibody, slc45a2.L antibody, Slc45a2 antibody

Background: SLC45A2 is a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4.

Molecular Weight: 51 kDa (MW of target protein)