ABCG5 antibody
-
- Target See all ABCG5 Antibodies
- ABCG5 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 5 (ABCG5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABCG5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH
- Top Product
- Discover our top product ABCG5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABCG5 Blocking Peptide, catalog no. 33R-1706, is also available for use as a blocking control in assays to test for specificity of this ABCG5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCG5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCG5 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 5 (ABCG5))
- Alternative Name
- ABCG5 (ABCG5 Products)
- Background
- The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily.
- Molecular Weight
- 72 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-