ABCG5 antibody

Catalog No. ABIN635285

The Rabbit Polyclonal anti-ABCG5 antibody is suitable to detect ABCG5 in samples from Human. It has been validated for WB.

Quick Overview for ABCG5 antibody (ABIN635285)

Target: ABCG5 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 5 (ABCG5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCG5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ABCG5 Antibody

Purification: Affinity purified

Immunogen: ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCG5 Blocking Peptide, (ABIN937092), is also available for use as a blocking control in assays to test for specificity of this ABCG5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCG5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCG5

Target: ABCG5 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 5 (ABCG5))

Alternative Name: ABCG5

Background: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily.

Molecular Weight: 72 kDa (MW of target protein)

Pathways: Lipid Metabolism