ABCC11 antibody

Catalog No. ABIN635292

This anti-ABCC11 antibody is a Rabbit Polyclonal antibody detecting ABCC11 in WB. Suitable for Human.

Quick Overview for ABCC11 antibody (ABIN635292)

Target: ABCC11 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCC11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ABCC11 Antibody

Purification: Affinity purified

Immunogen: ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCC11 Blocking Peptide, (ABIN5611858), is also available for use as a blocking control in assays to test for specificity of this ABCC11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCC11

Target: ABCC11 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11))

Alternative Name: ABCC11

Background: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Molecular Weight: 154 kDa (MW of target protein)