ACBD4 antibody (N-Term)

Catalog No. ABIN635315

The Rabbit Polyclonal anti-ACBD4 antibody has been validated for WB. It is suitable to detect ACBD4 in samples from Human, Mouse and Rat.

Quick Overview for ACBD4 antibody (N-Term) (ABIN635315)

Target: ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACBD4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACBD4 Antibody

Binding Specificity: N-Term

Specificity: ACBD4 antibody was raised against the N terminal of ACBD4

Purification: Affinity purified

Immunogen: ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACBD4 Blocking Peptide, (ABIN5611888), is also available for use as a blocking control in assays to test for specificity of this ACBD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACBD4

Target: ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))

Alternative Name: ACBD4

Background: ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.

Molecular Weight: 35 kDa (MW of target protein)