AADACL4 antibody (Middle Region)

Catalog No. ABIN635339

The Rabbit Polyclonal anti-AADACL4 antibody has been validated for WB. It is suitable to detect AADACL4 in samples from Human.

Quick Overview for AADACL4 antibody (Middle Region) (ABIN635339)

Target: AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AADACL4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AADACL4 Antibody

Binding Specificity: Middle Region

Specificity: AADACL4 antibody was raised against the middle region of AADACL4

Purification: Affinity purified

Immunogen: AADACL4 antibody was raised using the middle region of AADACL4 corresponding to a region with amino acids IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AADACL4 Blocking Peptide, (ABIN939514), is also available for use as a blocking control in assays to test for specificity of this AADACL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADACL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AADACL4

Target: AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))

Alternative Name: AADACL4

Background: The function of AADAC protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 46 kDa (MW of target protein)