B3GAT3 antibody
-
- Target See all B3GAT3 Antibodies
- B3GAT3 (beta-1,3-Glucuronyltransferase 3 (Glucuronosyltransferase I) (B3GAT3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This B3GAT3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- B3 GAT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY
- Top Product
- Discover our top product B3GAT3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
B3GAT3 Blocking Peptide, catalog no. 33R-7265, is also available for use as a blocking control in assays to test for specificity of this B3GAT3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 AT3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B3GAT3 (beta-1,3-Glucuronyltransferase 3 (Glucuronosyltransferase I) (B3GAT3))
- Alternative Name
- B3GAT3 (B3GAT3 Products)
- Synonyms
- GLCATI antibody, 2810405M13Rik antibody, GlcUAT-I antibody, Glcat-i antibody, beta-1,3-glucuronyltransferase 3 antibody, beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I) antibody, B3GAT3 antibody, B3gat3 antibody
- Background
- The protein encoded by this gene is a member of the glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product catalyzes the formation of the glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction in the final step of the biosynthesis of the linkage region of proteoglycans.
- Molecular Weight
- 37 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-