Calsyntenin 1 antibody (N-Term)

Catalog No. ABIN635351

The Rabbit Polyclonal anti-Calsyntenin 1 antibody has been validated for WB. It is suitable to detect Calsyntenin 1 in samples from Human.

Quick Overview for Calsyntenin 1 antibody (N-Term) (ABIN635351)

Target: Calsyntenin 1 (CLSTN1)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Calsyntenin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Calsyntenin 1 Antibody

Binding Specificity: N-Term

Specificity: Calsyntenin 1 antibody was raised against the N terminal of CLSTN1

Purification: Affinity purified

Immunogen: Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calsyntenin 1 Blocking Peptide, (ABIN939985), is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Calsyntenin 1

Target: Calsyntenin 1 (CLSTN1)

Alternative Name: Calsyntenin 1

Background: CLSTN1 induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, CLSTN1 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.

Molecular Weight: 110 kDa (MW of target protein)