Calsyntenin 1 antibody (N-Term)
-
- Target See all Calsyntenin 1 (CLSTN1) Antibodies
- Calsyntenin 1 (CLSTN1)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Calsyntenin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Calsyntenin 1 antibody was raised against the N terminal of CLSTN1
- Purification
- Affinity purified
- Immunogen
- Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI
- Top Product
- Discover our top product CLSTN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Calsyntenin 1 Blocking Peptide, catalog no. 33R-4599, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Calsyntenin 1 (CLSTN1)
- Alternative Name
- Calsyntenin 1 (CLSTN1 Products)
- Background
- CLSTN1 induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, CLSTN1 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.
- Molecular Weight
- 110 kDa (MW of target protein)
-