AWAT1 antibody (N-Term)

Catalog No. ABIN635354

Product Details anti-AWAT1 Antibody

Target: AWAT1 (Acyl-CoA Wax Alcohol Acyltransferase 1 (AWAT1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AWAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AWAT1 antibody was raised against the N terminal of AWAT1

Purification: Affinity purified

Immunogen: AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AWAT1 Blocking Peptide, catalog no. 33R-6931, is also available for use as a blocking control in assays to test for specificity of this AWAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AWAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AWAT1

Target: AWAT1 (Acyl-CoA Wax Alcohol Acyltransferase 1 (AWAT1))

Alternative Name: AWAT1 (AWAT1 Products)

Synonyms: DGAT2L3 antibody, Dgat2l3 antibody, dga2 antibody, dgat2l3 antibody, DGA2 antibody, acyl-CoA wax alcohol acyltransferase 1 antibody, acyl-CoA wax alcohol acyltransferase 1 L homeolog antibody, AWAT1 antibody, Awat1 antibody, awat1.L antibody, awat1 antibody

Background: The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin.

Molecular Weight: 38 kDa (MW of target protein)