ABHD12 antibody (Middle Region)

Catalog No. ABIN635357

The Rabbit Polyclonal anti-ABHD12 antibody has been validated for WB. It is suitable to detect ABHD12 in samples from Human.

Quick Overview for ABHD12 antibody (Middle Region) (ABIN635357)

Target: ABHD12 (Abhydrolase Domain Containing 12 (ABHD12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABHD12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ABHD12 Antibody

Binding Specificity: Middle Region

Specificity: ABHD12 antibody was raised against the middle region of ABHD12

Purification: Affinity purified

Immunogen: ABHD12 antibody was raised using the middle region of ABHD12 corresponding to a region with amino acids CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABHD12 Blocking Peptide, catalog no. 33R-1766, is also available for use as a blocking control in assays to test for specificity of this ABHD12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABHD12

Target: ABHD12 (Abhydrolase Domain Containing 12 (ABHD12))

Alternative Name: ABHD12

Background: ABHD12 may be a regulator of endocannabinoid signaling pathways.

Molecular Weight: 45 kDa (MW of target protein)