SLC37A4 antibody

Catalog No. ABIN635366

The Rabbit Polyclonal anti-SLC37A4 antibody has been validated for WB. It is suitable to detect SLC37A4 in samples from Human.

Quick Overview for SLC37A4 antibody (ABIN635366)

Target: SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC37A4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC37A4 Antibody

Purification: Affinity purified

Immunogen: SLC37 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC37A4 Blocking Peptide, (ABIN5616244), is also available for use as a blocking control in assays to test for specificity of this SLC37A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC37A4

Target: SLC37A4 (Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4))

Alternative Name: SLC37A4

Background: SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Cellular Glucan Metabolic Process