TTYH1 antibody

Catalog No. ABIN635388

This anti-TTYH1 antibody is a Rabbit Polyclonal antibody detecting TTYH1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for TTYH1 antibody (ABIN635388)

Target: TTYH1 (Tweety Homolog 1 (TTYH1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TTYH1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TTYH1 Antibody

Purification: Affinity purified

Immunogen: TTYH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TTYH1 Blocking Peptide, (ABIN938554), is also available for use as a blocking control in assays to test for specificity of this TTYH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTYH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TTYH1

Target: TTYH1 (Tweety Homolog 1 (TTYH1))

Alternative Name: TTYH1

Background: TTYH1 is a member of the tweety family of proteins. Members of this family function as chloride anion channels. TTYH1 functions as a calcium (2+)-independent, volume-sensitive large conductance chloride (-) channel. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene.

Molecular Weight: 49 kDa (MW of target protein)