GP2 antibody (Glycoprotein 2 (Zymogen Granule Membrane))

Details for Product anti-GP2 Antibody No. ABIN635391
Antigen
Reactivity
Human
93
10
5
1
1
1
Host
Rabbit
52
51
Clonality
Polyclonal
Conjugate
This GP2 antibody is un-conjugated
5
3
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
Application
Western Blotting (WB)
54
51
40
40
30
28
20
16
8
4
1
1
1
Options
Immunogen Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES
Purification Affinity purified
Antigen
Alternative Name Glycoprotein 2
Background GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.
Molecular Weight 43 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

Glycoprotein 2 Blocking Peptide, catalog no. 33R-8616, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein 2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GP2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Glycoprotein 2 (Zymogen Granule Membrane) (GP2) antibody (ABIN635391) Glycoprotein 2 antibody used at 1 ug/ml to detect target protein.