GP2 antibody

Catalog No. ABIN635391

The Rabbit Polyclonal anti-GP2 antibody (ABIN635391) specifically detects GP2 in WB. The antibody is reactive with Human samples.

Quick Overview for GP2 antibody (ABIN635391)

Target: GP2 (Glycoprotein 2 (Zymogen Granule Membrane) (GP2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GP2 Antibody

Purification: Affinity purified

Immunogen: Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Glycoprotein 2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Glycoprotein 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GP2

Target: GP2 (Glycoprotein 2 (Zymogen Granule Membrane) (GP2))

Alternative Name: Glycoprotein 2

Background: GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.

Molecular Weight: 43 kDa (MW of target protein)