GP2 antibody

Catalog No. ABIN635391

Product Details anti-GP2 Antibody

Target: GP2 (Glycoprotein 2 (Zymogen Granule Membrane) (GP2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Glycoprotein 2 Blocking Peptide, catalog no. 33R-8616, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GP2

Target: GP2 (Glycoprotein 2 (Zymogen Granule Membrane) (GP2))

Alternative Name: Glycoprotein 2 (GP2 Products)

Synonyms: ZAP75 antibody, 2310037I18Rik antibody, AV060639 antibody, gp80 antibody, glycoprotein 2 antibody, glycoprotein 2 (zymogen granule membrane) antibody, GP2 antibody, Gp2 antibody

Target Type: Viral Protein

Background: GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.

Molecular Weight: 43 kDa (MW of target protein)