LARGE antibody (Middle Region)

Catalog No. ABIN635429

The Rabbit Polyclonal anti-LARGE antibody has been validated for WB. It is suitable to detect LARGE in samples from Human.

Quick Overview for LARGE antibody (Middle Region) (ABIN635429)

Target: LARGE (Like-Glycosyltransferase (LARGE))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LARGE antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LARGE Antibody

Binding Specificity: Middle Region

Specificity: LARGE antibody was raised against the middle region of LARGE

Purification: Affinity purified

Immunogen: LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LARGE Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this LARGE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARGE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LARGE

Target: LARGE (Like-Glycosyltransferase (LARGE))

Alternative Name: LARGE

Background: This gene, which is one of the largest in the human genome, encodes a glycosyltransferase which participates in glycosylation of alpha-dystroglycan.

Molecular Weight: 88 kDa (MW of target protein)