RER1 antibody

Catalog No. ABIN635434

This Rabbit Polyclonal antibody specifically detects RER1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RER1 antibody (ABIN635434)

Target: RER1 (RER1 Retention in Endoplasmic Reticulum 1 Homolog (RER1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RER1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RER1 Antibody

Purification: Affinity purified

Immunogen: RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RER1 Blocking Peptide, (ABIN938735), is also available for use as a blocking control in assays to test for specificity of this RER1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RER1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RER1

Target: RER1 (RER1 Retention in Endoplasmic Reticulum 1 Homolog (RER1))

Alternative Name: RER1

Background: RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.

Molecular Weight: 23 kDa (MW of target protein)