C19orf56 antibody (N-Term)

Catalog No. ABIN635449

This Rabbit Polyclonal antibody specifically detects C19orf56 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for C19orf56 antibody (N-Term) (ABIN635449)

Target: C19orf56 (Chromosome 19 Open Reading Frame 56 (C19orf56))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C19orf56 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C19orf56 Antibody

Binding Specificity: N-Term

Specificity: C19 ORF56 antibody was raised against the N terminal Of C19 rf56

Purification: Affinity purified

Immunogen: C19 ORF56 antibody was raised using the N terminal Of C19 rf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C19ORF56 Blocking Peptide, (ABIN5612447), is also available for use as a blocking control in assays to test for specificity of this C19ORF56 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF56 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C19orf56

Target: C19orf56 (Chromosome 19 Open Reading Frame 56 (C19orf56))

Alternative Name: C19ORF56

Background: The function of C19orf56 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 12 kDa (MW of target protein)