CACHD1 antibody (N-Term)

Catalog No. ABIN635475

Product Details anti-CACHD1 Antibody

Target: CACHD1 (Cache Domain Containing 1 (CACHD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CACHD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CACHD1 antibody was raised against the N terminal of CACHD1

Purification: Affinity purified

Immunogen: CACHD1 antibody was raised using the N terminal of CACHD1 corresponding to a region with amino acids HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CACHD1 Blocking Peptide, catalog no. 33R-3761, is also available for use as a blocking control in assays to test for specificity of this CACHD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACHD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CACHD1

Target: CACHD1 (Cache Domain Containing 1 (CACHD1))

Alternative Name: CACHD1 (CACHD1 Products)

Synonyms: CACHD1 antibody, RP4-655E10.1 antibody, 1190007F10Rik antibody, AI852726 antibody, B430218L07Rik antibody, Vwcd1 antibody, mKIAA1573 antibody, RGD1310770 antibody, cache domain containing 1 antibody, VWFA and cache domain-containing protein 1 antibody, CACHD1 antibody, LOC593655 antibody, cachd1 antibody, Cachd1 antibody

Background: CACHD1 belongs to the calcium channel subunit alpha-2/delta family. It contains 2 cache domains and 1 VWFA domain. CACHD1 may regulate voltage-dependent calcium channels.

Molecular Weight: 137 kDa (MW of target protein)