STEAP4 antibody (C-Term)

Catalog No. ABIN635483

The Rabbit Polyclonal anti-STEAP4 antibody has been validated for WB. It is suitable to detect STEAP4 in samples from Human.

Quick Overview for STEAP4 antibody (C-Term) (ABIN635483)

Target: STEAP4 (STEAP Family Member 4 (STEAP4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STEAP4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-STEAP4 Antibody

Binding Specificity: C-Term

Specificity: STEAP4 antibody was raised against the C terminal of STEAP4

Purification: Affinity purified

Immunogen: STEAP4 antibody was raised using the C terminal of STEAP4 corresponding to a region with amino acids AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STEAP4 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this STEAP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STEAP4

Target: STEAP4 (STEAP Family Member 4 (STEAP4))

Alternative Name: STEAP4

Background: Metalloreductase has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). It uses NAD(+) as acceptor.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis