Claudin 18 antibody (Middle Region)

Catalog No. ABIN635504

The Rabbit Polyclonal anti-Claudin 18 antibody has been validated for WB. It is suitable to detect Claudin 18 in samples from Human, Mouse and Rat.

Quick Overview for Claudin 18 antibody (Middle Region) (ABIN635504)

Target: Claudin 18 (CLDN18)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 18 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Claudin 18 Antibody

Binding Specificity: Middle Region

Specificity: Claudin 18 antibody was raised against the middle region of CLDN18

Purification: Affinity purified

Immunogen: Claudin 18 antibody was raised using the middle region of CLDN18 corresponding to a region with amino acids LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 18 Blocking Peptide, (ABIN5612908), is also available for use as a blocking control in assays to test for specificity of this Claudin 18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 18

Target: Claudin 18 (CLDN18)

Alternative Name: Claudin 18

Background: CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C