ACSL1 antibody (C-Term)
-
- Target See all ACSL1 (Acsl1) Antibodies
- ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACSL1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ACSL1 antibody was raised against the C terminal of ACSL1
- Purification
- Affinity purified
- Immunogen
- ACSL1 antibody was raised using the C terminal of ACSL1 corresponding to a region with amino acids GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
- Top Product
- Discover our top product Acsl1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACSL1 Blocking Peptide, catalog no. 33R-3560, is also available for use as a blocking control in assays to test for specificity of this ACSL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))
- Alternative Name
- ACSL1 (Acsl1 Products)
- Synonyms
- ACS1 antibody, FACL1 antibody, FACL2 antibody, LACS antibody, LACS1 antibody, LACS2 antibody, Acas antibody, Acas1 antibody, Acs antibody, FACS antibody, Facl2 antibody, ACS antibody, COAA antibody, zgc:110081 antibody, CER8 antibody, ECERIFERUM 8 antibody, LONG-CHAIN ACYL-COA SYNTHASE 1 antibody, T8I13.8 antibody, F13F21.14 antibody, F13F21_14 antibody, LATERAL ROOT DEVELOPMENT 2 antibody, LRD2 antibody, long-chain acyl-CoA synthetase 2 antibody, acyl-CoA synthetase long chain family member 1 antibody, acyl-CoA synthetase long-chain family member 1 antibody, acyl-CoA synthetase long chain family member 1a antibody, AMP-dependent synthetase and ligase family protein antibody, long-chain acyl-CoA synthetase 2 antibody, ACSL1 antibody, Acsl1 antibody, acsl1a antibody, LACS1 antibody, LACS2 antibody
- Background
- ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.
- Molecular Weight
- 78 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-