ODF4 antibody (N-Term)

Catalog No. ABIN635515

Product Details anti-ODF4 Antibody

Target: ODF4 (Outer Dense Fiber of Sperm Tails 4 (ODF4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ODF4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ODF4 antibody was raised against the N terminal of ODF4

Purification: Affinity purified

Immunogen: ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ODF4 Blocking Peptide, catalog no. 33R-5819, is also available for use as a blocking control in assays to test for specificity of this ODF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ODF4

Target: ODF4 (Outer Dense Fiber of Sperm Tails 4 (ODF4))

Alternative Name: ODF4 (ODF4 Products)

Synonyms: CT134 antibody, CT136 antibody, OPPO1 antibody, Oppo1 antibody, outer dense fiber of sperm tails 4 antibody, ODF4 antibody, Odf4 antibody

Background: ODF4 is the component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton.

Molecular Weight: 29 kDa (MW of target protein)