HEPACAM antibody (N-Term)

Catalog No. ABIN635516

Product Details anti-HEPACAM Antibody

Target: HEPACAM (Hepatic and Glial Cell Adhesion Molecule (HEPACAM))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HEPACAM antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HEPACAM antibody was raised against the N terminal of HEPACAM

Purification: Affinity purified

Immunogen: HEPACAM antibody was raised using the N terminal of HEPACAM corresponding to a region with amino acids LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HEPACAM Blocking Peptide, catalog no. 33R-5163, is also available for use as a blocking control in assays to test for specificity of this HEPACAM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEPACAM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HEPACAM

Target: HEPACAM (Hepatic and Glial Cell Adhesion Molecule (HEPACAM))

Alternative Name: HEPACAM (HEPACAM Products)

Synonyms: GlialCAM antibody, MLC2A antibody, MLC2B antibody, 2900042E01Rik antibody, Hepn1 antibody, hepatic and glial cell adhesion molecule antibody, hepatocyte cell adhesion molecule antibody, HEPACAM antibody, Hepacam antibody

Background: HEPACAM is involved in regulating cell motility and cell-matrix interactions. HEPACAM may inhibit cell growth through suppression of cell proliferation.

Molecular Weight: 46 kDa (MW of target protein)