Seladin 1 antibody (Middle Region)

Catalog No. ABIN635527

Product Details anti-Seladin 1 Antibody

Target: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Seladin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DHCR24 antibody was raised against the middle region of DHCR24

Purification: Affinity purified

Immunogen: DHCR24 antibody was raised using the middle region of DHCR24 corresponding to a region with amino acids AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHCR24 Blocking Peptide, catalog no. 33R-1138, is also available for use as a blocking control in assays to test for specificity of this DHCR24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHCR24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Seladin 1

Target: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Alternative Name: DHCR24 (DHCR24 Products)

Synonyms: MGC82737 antibody, zgc:101638 antibody, DCE antibody, Nbla03646 antibody, SELADIN1 antibody, seladin-1 antibody, 2310076D10Rik antibody, 5830417J06Rik antibody, mKIAA0018 antibody, 24-dehydrocholesterol reductase antibody, 24-dehydrocholesterol reductase S homeolog antibody, delta(24)-sterol reductase antibody, DHCR24 antibody, dhcr24.S antibody, dhcr24 antibody, LOC5575872 antibody, CpipJ_CPIJ000670 antibody, Dhcr24 antibody

Background: DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis.

Molecular Weight: 58 kDa (MW of target protein)