WNT5A antibody (Middle Region)
-
- Target See all WNT5A Antibodies
- WNT5A (Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WNT5A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WNT5 A antibody was raised against the middle region of WNT5
- Purification
- Affinity purified
- Immunogen
- WNT5 A antibody was raised using the middle region of WNT5 corresponding to a region with amino acids GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT
- Top Product
- Discover our top product WNT5A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WNT5A Blocking Peptide, catalog no. 33R-3274, is also available for use as a blocking control in assays to test for specificity of this WNT5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT5A (Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A))
- Alternative Name
- WNT5A (WNT5A Products)
- Background
- The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- WNT Signaling, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Regulation of Cell Size, Tube Formation
-