WNT5A antibody (Middle Region)

Catalog No. ABIN635529

Product Details anti-WNT5A Antibody

Target: WNT5A (Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WNT5A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WNT5 A antibody was raised against the middle region of WNT5

Purification: Affinity purified

Immunogen: WNT5 A antibody was raised using the middle region of WNT5 corresponding to a region with amino acids GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WNT5A Blocking Peptide, catalog no. 33R-3274, is also available for use as a blocking control in assays to test for specificity of this WNT5A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WNT5A

Target: WNT5A (Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A))

Alternative Name: WNT5A (WNT5A Products)

Background: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: WNT Signaling, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Regulation of Cell Size, Tube Formation