UNC5A antibody

Catalog No. ABIN635530

This Rabbit Polyclonal antibody specifically detects UNC5A in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for UNC5A antibody (ABIN635530)

Target: UNC5A (Unc-5 Homolog A (UNC5A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UNC5A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UNC5A Antibody

Purification: Affinity purified

Immunogen: UNC5 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UNC5A Blocking Peptide, (ABIN5616911), is also available for use as a blocking control in assays to test for specificity of this UNC5A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UNC5A

Target: UNC5A (Unc-5 Homolog A (UNC5A))

Alternative Name: UNC5A

Background: UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.

Molecular Weight: 93 kDa (MW of target protein)