Reticulon 1 antibody (N-Term)

Catalog No. ABIN635538

Product Details anti-Reticulon 1 Antibody

Target: Reticulon 1 (RTN1)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Reticulon 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RTN1 antibody was raised against the N terminal of RTN1

Purification: Affinity purified

Immunogen: RTN1 antibody was raised using the N terminal of RTN1 corresponding to a region with amino acids EEREAELDSELIIESCDASSASEESPKREQDSPPMKPSALDAIREETGVR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RTN1 Blocking Peptide, catalog no. 33R-2384, is also available for use as a blocking control in assays to test for specificity of this RTN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Reticulon 1

Target: Reticulon 1 (RTN1)

Alternative Name: RTN1 (RTN1 Products)

Synonyms: NSP antibody, 0710005K15Rik antibody, 4930441F12Rik antibody, Nsp antibody, R75279 antibody, Rtn1-a antibody, Rtn1-b antibody, Rtn1-c antibody, reticulon-1 antibody, RTN1 antibody, RTN1-Cw antibody, rtn1 antibody, XRTN1-A antibody, XRTN1-C.1 antibody, xrtn1 antibody, xrtn1-c antibody, RTN1.2 antibody, Rtn1-C.2 antibody, rtn1-a antibody, rtn1b antibody, xRTN1 antibody, RTN1.1 antibody, rtn1a antibody, xrtn1-c.1 antibody, rtn1l antibody, wu:fa21b09 antibody, wu:fj35h01 antibody, reticulon 1 antibody, reticulon-1 antibody, reticulon 1 S homeolog antibody, reticulon 1 L homeolog antibody, reticulon 1b antibody, RTN1 antibody, Rtn1 antibody, rtn1 antibody, Rtnl1 antibody, LOC100580843 antibody, rtn1.S antibody, rtn1.L antibody, LOC100339591 antibody, rtn1b antibody

Background: Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.

Molecular Weight: 39 kDa (MW of target protein)