ABCC1 antibody

Catalog No. ABIN635554

This Rabbit Polyclonal antibody specifically detects ABCC1 in WB. It exhibits reactivity toward Human and Dog.

Quick Overview for ABCC1 antibody (ABIN635554)

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ABCC1 Antibody

Purification: Affinity purified

Immunogen: ABCC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCC1 Blocking Peptide, (ABIN940327), is also available for use as a blocking control in assays to test for specificity of this ABCC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCC1

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Alternative Name: ABCC1

Background: ABCC1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates.

Molecular Weight: 171 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome