MAN1A2 antibody (Middle Region)

Catalog No. ABIN635557

This Rabbit Polyclonal antibody specifically detects MAN1A2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MAN1A2 antibody (Middle Region) (ABIN635557)

Target: MAN1A2 (Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAN1A2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAN1A2 Antibody

Binding Specificity: Middle Region

Specificity: MAN1 A2 antibody was raised against the middle region of MAN1 2

Purification: Affinity purified

Immunogen: MAN1 A2 antibody was raised using the middle region of MAN1 2 corresponding to a region with amino acids FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAN1A2 Blocking Peptide, (ABIN938230), is also available for use as a blocking control in assays to test for specificity of this MAN1A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAN0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAN1A2

Target: MAN1A2 (Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2))

Alternative Name: MAN1A2

Background: Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells.

Molecular Weight: 73 kDa (MW of target protein)