TXNDC16 antibody (N-Term)

Catalog No. ABIN635558

Product Details anti-TXNDC16 Antibody

Target: TXNDC16 (Thioredoxin Domain Containing 16 (TXNDC16))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TXNDC16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TXNDC16 antibody was raised against the N terminal of TXNDC16

Purification: Affinity purified

Immunogen: TXNDC16 antibody was raised using the N terminal of TXNDC16 corresponding to a region with amino acids EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TXNDC16 Blocking Peptide, catalog no. 33R-2774, is also available for use as a blocking control in assays to test for specificity of this TXNDC16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TXNDC16

Target: TXNDC16 (Thioredoxin Domain Containing 16 (TXNDC16))

Alternative Name: TXNDC16 (TXNDC16 Products)

Synonyms: ERp90 antibody, KIAA1344 antibody, 5730420B22Rik antibody, C77647 antibody, RGD1306755 antibody, thioredoxin domain containing 16 antibody, TXNDC16 antibody, Txndc16 antibody

Background: TXNDC16 contains 1 thioredoxin domain. The exact function of TXNDC16 remains unknown.

Molecular Weight: 93 kDa (MW of target protein)