UBAC2 antibody (Middle Region)

Catalog No. ABIN635562

The Rabbit Polyclonal anti-UBAC2 antibody (ABIN635562) specifically detects UBAC2 in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for UBAC2 antibody (Middle Region) (ABIN635562)

Target: UBAC2 (UBA Domain Containing 2 (UBAC2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBAC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBAC2 Antibody

Binding Specificity: Middle Region

Specificity: UBAC2 antibody was raised against the middle region of UBAC2

Purification: Affinity purified

Immunogen: UBAC2 antibody was raised using the middle region of UBAC2 corresponding to a region with amino acids YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBAC2 Blocking Peptide, (ABIN936019), is also available for use as a blocking control in assays to test for specificity of this UBAC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBAC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBAC2

Target: UBAC2 (UBA Domain Containing 2 (UBAC2))

Alternative Name: UBAC2

Background: The function of UBAC2 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 35 kDa (MW of target protein)