SLC26A4 antibody (Middle Region)

Catalog No. ABIN635614

This Rabbit Polyclonal antibody specifically detects SLC26A4 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for SLC26A4 antibody (Middle Region) (ABIN635614)

Target: SLC26A4 (Solute Carrier Family 26, Member 4 (SLC26A4))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC26A4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC26A4 Antibody

Binding Specificity: Middle Region

Specificity: SLC26 A4 antibody was raised against the middle region of SLC26 4

Purification: Affinity purified

Immunogen: SLC26 A4 antibody was raised using the middle region of SLC26 4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC26A4 Blocking Peptide, (ABIN937949), is also available for use as a blocking control in assays to test for specificity of this SLC26A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC26A4

Target: SLC26A4 (Solute Carrier Family 26, Member 4 (SLC26A4))

Alternative Name: SLC26A4

Background: Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene.

Molecular Weight: 86 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Sensory Perception of Sound