Klotho beta antibody (Middle Region)

Catalog No. ABIN635626

This Rabbit Polyclonal antibody specifically detects Klotho beta in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Klotho beta antibody (Middle Region) (ABIN635626)

Target: Klotho beta (KLB)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Klotho beta antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Klotho beta Antibody

Binding Specificity: Middle Region

Specificity: Klotho Beta antibody was raised against the middle region of KLB

Purification: Affinity purified

Immunogen: Klotho Beta antibody was raised using the middle region of KLB corresponding to a region with amino acids DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Klotho Beta Blocking Peptide, (ABIN937254), is also available for use as a blocking control in assays to test for specificity of this Klotho Beta antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Klotho beta

Target: Klotho beta (KLB)

Alternative Name: Klotho beta

Background: KLB is a single-pass type III membrane protein. It contributes to the transcriptional repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. KLB is probably inactive as a glycosidase. It increases the ability of FGFR1 and FGFR4 to bind FGF21.

Molecular Weight: 120 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Growth Factor Binding