Surfactant Protein C antibody (N-Term)

Catalog No. ABIN635635

Product Details anti-Surfactant Protein C Antibody

Target: Surfactant Protein C (SFTPC)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Surfactant Protein C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SFTPC antibody was raised against the N terminal of SFTPC

Purification: Affinity purified

Immunogen: SFTPC antibody was raised using the N terminal of SFTPC corresponding to a region with amino acids MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFTPC Blocking Peptide, catalog no. 33R-5881, is also available for use as a blocking control in assays to test for specificity of this SFTPC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Surfactant Protein C

Target: Surfactant Protein C (SFTPC)

Alternative Name: SFTPC (SFTPC Products)

Synonyms: SFTPC antibody, SPC antibody, SP-C antibody, psp-c antibody, sftp2 antibody, xSP-C antibody, Bricd6 antibody, SP5 antibody, Sftp-2 antibody, Sftp2 antibody, pro-SpC antibody, BRICD6 antibody, PSP-C antibody, SFTP2 antibody, SMDP2 antibody, surfactant protein C antibody, surfactant, pulmonary-associated protein C S homeolog antibody, surfactant, pulmonary-associated protein C antibody, surfactant associated protein C antibody, SFTPC antibody, sftpc.S antibody, sftpc antibody, Sftpc antibody

Background: This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids.

Molecular Weight: 21 kDa (MW of target protein)