TMEM63A antibody (N-Term)

Catalog No. ABIN635671

Product Details anti-TMEM63A Antibody

Target: TMEM63A (Transmembrane Protein 63A (TMEM63A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM63A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM63 A antibody was raised against the N terminal of TMEM63

Purification: Affinity purified

Immunogen: TMEM63 A antibody was raised using the N terminal of TMEM63 corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM63A Blocking Peptide, catalog no. 33R-5872, is also available for use as a blocking control in assays to test for specificity of this TMEM63A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM63A

Target: TMEM63A (Transmembrane Protein 63A (TMEM63A))

Alternative Name: TMEM63A (TMEM63A Products)

Synonyms: si:ch211-117l16.1 antibody, KIAA0792 antibody, BC014795 antibody, Tmem64a antibody, RGD1306829 antibody, Tmem6 antibody, transmembrane protein 63A antibody, transmembrane protein 63a antibody, tmem63a antibody, CpipJ_CPIJ011090 antibody, TMEM63A antibody, Tmem63a antibody

Background: TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.

Molecular Weight: 89 kDa (MW of target protein)