DLL3 antibody

Catalog No. ABIN635694

This anti-DLL3 antibody is a Rabbit Polyclonal antibody detecting DLL3 in WB. Suitable for Human.

Quick Overview for DLL3 antibody (ABIN635694)

Target: DLL3 (delta Like Protein 3 (DLL3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLL3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DLL3 Antibody

Purification: Affinity purified

Immunogen: DLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLL3 Blocking Peptide, (ABIN5613218), is also available for use as a blocking control in assays to test for specificity of this DLL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLL3

Target: DLL3 (delta Like Protein 3 (DLL3))

Alternative Name: DLL3

Background: DLL3 is a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Notch Signaling